PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang01g10880.7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family ZF-HD
Protein Properties Length: 92aa    MW: 10604.2 Da    PI: 10.1258
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang01g10880.7genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer409.2e-131292958
     ZF-HD_dimer 29 mpsegeegtaaalkCaACgCHRnFHRreve 58
                    mp+ ge+gt +a+ CaAC+CHRnFHR++++
  Vang01g10880.7  1 MPA-GEDGTLEAVICAACNCHRNFHRKSKK 29
                    566.888********************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5152311.691127IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.8E-11128IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-6124IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.606.3E-312290IPR009057Homeodomain-like
SuperFamilySSF466898.32E-212289IPR009057Homeodomain-like
TIGRFAMsTIGR015654.1E-262885IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
MPAGEDGTLE AVICAACNCH RNFHRKSKKR FRTKFTQEQK DKMLAFAEQV GWRIQKHDES  60
AVEQFCAETN VERKVLKVWM HNNKNTLGKK P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-3027861675ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150361e-106AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001777987.18e-41predicted protein
RefseqXP_013602497.11e-40PREDICTED: zinc-finger homeodomain protein 2-like
RefseqXP_013723545.11e-40PREDICTED: zinc-finger homeodomain protein 2-like
RefseqXP_014503688.15e-40PREDICTED: zinc-finger homeodomain protein 2-like
SwissprotQ6YXH52e-34ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLM0TIU33e-42M0TIU3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P19060_0018e-42(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.16e-29homeobox protein 22